Lineage for d6k9ra_ (6k9r A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2389728Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2389773Protein Xylanase II [49979] (21 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2389887Species Trichoderma reesei [TaxId:1344414] [383615] (12 PDB entries)
  8. 2389897Domain d6k9ra_: 6k9r A: [388894]
    automated match to d4xqwa_
    complexed with iod, xyp

Details for d6k9ra_

PDB Entry: 6k9r (more details), 1.3 Å

PDB Description: crystal structure analysis of endo-beta-1,4-xylanase ii complexed with xylotriose
PDB Compounds: (A:) Endo-1,4-beta-xylanase 2

SCOPe Domain Sequences for d6k9ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k9ra_ b.29.1.11 (A:) Xylanase II {Trichoderma reesei [TaxId: 1344414]}
tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgefvggkgwqpgtknkvin
fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavqgyfs
sgsasitvs

SCOPe Domain Coordinates for d6k9ra_:

Click to download the PDB-style file with coordinates for d6k9ra_.
(The format of our PDB-style files is described here.)

Timeline for d6k9ra_: