Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
Protein Xylanase II [49979] (21 species) Partial overlap with common fold and the active sites of the other endoglucanases |
Species Trichoderma reesei [TaxId:1344414] [383615] (12 PDB entries) |
Domain d6k9ra_: 6k9r A: [388894] automated match to d4xqwa_ complexed with iod, xyp |
PDB Entry: 6k9r (more details), 1.3 Å
SCOPe Domain Sequences for d6k9ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6k9ra_ b.29.1.11 (A:) Xylanase II {Trichoderma reesei [TaxId: 1344414]} tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgefvggkgwqpgtknkvin fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavqgyfs sgsasitvs
Timeline for d6k9ra_: