Lineage for d2mnr_2 (2mnr 3-132)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32233Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
  4. 32234Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 32235Family d.54.1.1: Enolase N-terminal domain-like [54827] (6 proteins)
  6. 32281Protein Mandelate racemase [54838] (1 species)
  7. 32282Species Pseudomonas putida [TaxId:303] [54839] (6 PDB entries)
  8. 32283Domain d2mnr_2: 2mnr 3-132 [38889]
    Other proteins in same PDB: d2mnr_1

Details for d2mnr_2

PDB Entry: 2mnr (more details), 1.9 Å

PDB Description: mechanism of the reaction catalyzed by mandelate racemase. 2. crystal structure of mandelate racemase at 2.5 angstroms resolution: identification of the active site and possible catalytic residues
PDB Compounds: ( :)

SCOP Domain Sequences for d2mnr_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mnr_2 d.54.1.1 (3-132) Mandelate racemase {Pseudomonas putida}
evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp
lvkllganar

SCOP Domain Coordinates for d2mnr_2:

Click to download the PDB-style file with coordinates for d2mnr_2.
(The format of our PDB-style files is described here.)

Timeline for d2mnr_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mnr_1