![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (49 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [272122] (17 PDB entries) |
![]() | Domain d6kuzc1: 6kuz C:3-219 [388869] Other proteins in same PDB: d6kuza2, d6kuza3, d6kuza4, d6kuza5, d6kuzb2, d6kuzb3, d6kuzb4, d6kuzb5, d6kuzc2, d6kuzc3, d6kuzc4, d6kuzc5, d6kuzd2, d6kuzd3, d6kuzd4, d6kuzd5 automated match to d1f4ha3 complexed with dms, dvl, gol, mg, na |
PDB Entry: 6kuz (more details), 2.83 Å
SCOPe Domain Sequences for d6kuzc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kuzc1 b.18.1.0 (C:3-219) automated matches {Escherichia coli [TaxId: 83333]} itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d6kuzc1:
![]() Domains from same chain: (mouse over for more information) d6kuzc2, d6kuzc3, d6kuzc4, d6kuzc5 |