Lineage for d7brna1 (7brn A:3-133)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502613Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2502614Protein automated matches [190233] (31 species)
    not a true protein
  7. 2502629Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193300] (9 PDB entries)
  8. 3088783Domain d7brna1: 7brn A:3-133 [388845]
    Other proteins in same PDB: d7brna2
    automated match to d5v4ka_
    complexed with ale, edo

Details for d7brna1

PDB Entry: 7brn (more details), 2.23 Å

PDB Description: crystal structure of atg40 aim fused to atg8
PDB Compounds: (A:) Autophagy-related protein 40,Autophagy-related protein 8

SCOPe Domain Sequences for d7brna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7brna1 d.15.1.0 (A:3-133) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
efpndydfmedildetmkstfkseypfekrkaeseriadrfpnripvicekaeksdipei
dkrkylvpadltvgqfvyvirkrimlppekaififvndtlpptaalmsaiyqehkdkdgf
lyvtysgentf

SCOPe Domain Coordinates for d7brna1:

Click to download the PDB-style file with coordinates for d7brna1.
(The format of our PDB-style files is described here.)

Timeline for d7brna1:

  • d7brna1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d7brna2