Lineage for d1bkhc2 (1bkh C:4-130)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32233Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
  4. 32234Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 32235Family d.54.1.1: Enolase N-terminal domain-like [54827] (6 protein domains)
  6. 32289Protein Muconate-lactonizing enzyme (cis muconate cycloisomerase) [54836] (1 species)
  7. 32290Species Pseudomonas putida [TaxId:303] [54837] (4 PDB entries)
  8. 32295Domain d1bkhc2: 1bkh C:4-130 [38884]
    Other proteins in same PDB: d1bkha1, d1bkhb1, d1bkhc1

Details for d1bkhc2

PDB Entry: 1bkh (more details), 2.1 Å

PDB Description: muconate lactonizing enzyme from pseudomonas putida

SCOP Domain Sequences for d1bkhc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bkhc2 d.54.1.1 (C:4-130) Muconate-lactonizing enzyme (cis muconate cycloisomerase) {Pseudomonas putida}
alieridaiivdlptiqqqtlvvlrvrcsdgvegigeattigglaygyespegikanida
hlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglpvsellgg

SCOP Domain Coordinates for d1bkhc2:

Click to download the PDB-style file with coordinates for d1bkhc2.
(The format of our PDB-style files is described here.)

Timeline for d1bkhc2: