Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein automated matches [190161] (29 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:1276653] [388782] (1 PDB entry) |
Domain d6xj3d_: 6xj3 D: [388832] automated match to d1k38a_ complexed with ca, edo, nxl, peg, trs |
PDB Entry: 6xj3 (more details), 1.85 Å
SCOPe Domain Sequences for d6xj3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xj3d_ e.3.1.1 (D:) automated matches {Klebsiella pneumoniae [TaxId: 1276653]} tlersdwrkffsefqakgtivvaderqadramlvfdpvrskkryspastfkiphtlfald agavrdefqifrwdgvnrgfaghnqdqdlrsamrnstvwvyelfakeigddkarrylkki dygnadpstsngdywiegslaisaqeqiaflrklyrnelpfrvehqrlvkdlmiveagrn wilraktgwegrmgwwvgwvewptgsvffalnidtpnrmddlfkreaivrailrsiealp p
Timeline for d6xj3d_: