SCOP 1.71: Domain d1bkhb2: 1bkh B:4-130

Lineage for d1bkhb2 (1bkh B:4-130)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (12 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Muconate-lactonizing enzyme (cis muconate cycloisomerase) [54836] (1 species)

7. Species Pseudomonas putida [TaxId:303] [54837] (5 PDB entries)

8. Domain d1bkhb2: 1bkh B:4-130 [38883]
   Other proteins in same PDB: d1bkha1, d1bkhb1, d1bkhc1

Details for d1bkhb2

PDB Entry: 1bkh, 2.1 Å

PDB Description: muconate lactonizing enzyme from pseudomonas putida

PDB Compounds: (B:)

SCOP Domain Sequences for d1bkhb2:

Sequence; same for both SEQRES and ATOM records:

>d1bkhb2 d.54.1.1 (B:4-130) Muconate-lactonizing enzyme (cis muconate cycloisomerase) {Pseudomonas putida}
alieridaiivdlptirpqqqtlvvlrvrcsdgvegigeattigglaygyespegikani
dahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglpvsellgg

Timeline for d1bkhb2:

• d1bkhb2 first appeared (with stable ids) in SCOP 1.55
  
• d1bkhb2 appears in SCOP 1.69
  
• d1bkhb2 appears in SCOP 1.73
  
• d1bkhb2 appears in the current release, SCOPe 2.07