SCOPe 2.08: Domain d6z3jb_: 6z3j B:

Lineage for d6z3jb_ (6z3j B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.0: automated matches [191392] (1 protein)
   not a true family

6. Protein automated matches [190506] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187459] (39 PDB entries)

8. Domain d6z3jb_: 6z3j B: [388825]
   automated match to d1m4ul_
   complexed with cl, edo, gol, nag, so4

Details for d6z3jb_

PDB Entry: 6z3j, 1.65 Å

PDB Description: repulsive guidance molecule b (rgmb) in complex with growth differentiation factor 5 (gdf5) (crystal form 1)

PDB Compounds: (B:) Growth/differentiation factor 5

SCOPe Domain Sequences for d6z3jb_:

Sequence; same for both SEQRES and ATOM records:

>d6z3jb_ g.17.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkarcsrkalhvnfkdmgwddwiiapleyeafhceglcefplrshleptnhaviqtlmns
mdpestpptccvptrlspisilfidsannvvkkdyedmvvescgcr

Timeline for d6z3jb_:

• d6z3jb_ first appeared in SCOPe 2.07