Lineage for d1bkha2 (1bkh A:4-130)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503550Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 503551Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 503552Family d.54.1.1: Enolase N-terminal domain-like [54827] (10 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 503665Protein Muconate-lactonizing enzyme (cis muconate cycloisomerase) [54836] (1 species)
  7. 503666Species Pseudomonas putida [TaxId:303] [54837] (5 PDB entries)
  8. 503669Domain d1bkha2: 1bkh A:4-130 [38882]
    Other proteins in same PDB: d1bkha1, d1bkhb1, d1bkhc1

Details for d1bkha2

PDB Entry: 1bkh (more details), 2.1 Å

PDB Description: muconate lactonizing enzyme from pseudomonas putida

SCOP Domain Sequences for d1bkha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bkha2 d.54.1.1 (A:4-130) Muconate-lactonizing enzyme (cis muconate cycloisomerase) {Pseudomonas putida}
alieridaiivdlptiqqtlvvlrvrcsdgvegigeattigglaygyespegikanidah
lapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglpvsellgg

SCOP Domain Coordinates for d1bkha2:

Click to download the PDB-style file with coordinates for d1bkha2.
(The format of our PDB-style files is described here.)

Timeline for d1bkha2: