Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) |
Family d.54.1.1: Enolase N-terminal domain-like [54827] (10 proteins) C-terminal domain is beta/alpha-barrel |
Protein Muconate-lactonizing enzyme (cis muconate cycloisomerase) [54836] (1 species) |
Species Pseudomonas putida [TaxId:303] [54837] (5 PDB entries) |
Domain d1bkha2: 1bkh A:4-130 [38882] Other proteins in same PDB: d1bkha1, d1bkhb1, d1bkhc1 |
PDB Entry: 1bkh (more details), 2.1 Å
SCOP Domain Sequences for d1bkha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bkha2 d.54.1.1 (A:4-130) Muconate-lactonizing enzyme (cis muconate cycloisomerase) {Pseudomonas putida} alieridaiivdlptiqqtlvvlrvrcsdgvegigeattigglaygyespegikanidah lapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglpvsellgg
Timeline for d1bkha2:
View in 3D Domains from other chains: (mouse over for more information) d1bkhb1, d1bkhb2, d1bkhc1, d1bkhc2 |