Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (125 species) not a true protein |
Species Escherichia coli [TaxId:83333] [272137] (17 PDB entries) |
Domain d6x1qd3: 6x1q D:334-625 [388810] Other proteins in same PDB: d6x1qa1, d6x1qa2, d6x1qa4, d6x1qa5, d6x1qb1, d6x1qb2, d6x1qb4, d6x1qb5, d6x1qc1, d6x1qc2, d6x1qc4, d6x1qc5, d6x1qd1, d6x1qd2, d6x1qd4, d6x1qd5 automated match to d1jz7a5 complexed with mg, na |
PDB Entry: 6x1q (more details), 1.8 Å
SCOPe Domain Sequences for d6x1qd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6x1qd3 c.1.8.0 (D:334-625) automated matches {Escherichia coli [TaxId: 83333]} vvriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d6x1qd3:
View in 3D Domains from same chain: (mouse over for more information) d6x1qd1, d6x1qd2, d6x1qd4, d6x1qd5 |