![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
![]() | Protein automated matches [254633] (16 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries) |
![]() | Domain d6x1qd2: 6x1q D:220-333 [388809] Other proteins in same PDB: d6x1qa1, d6x1qa3, d6x1qa5, d6x1qb1, d6x1qb3, d6x1qb5, d6x1qc1, d6x1qc3, d6x1qc5, d6x1qd1, d6x1qd3, d6x1qd5 automated match to d1jz8a1 complexed with mg, na |
PDB Entry: 6x1q (more details), 1.8 Å
SCOPe Domain Sequences for d6x1qd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6x1qd2 b.1.4.0 (D:220-333) automated matches {Escherichia coli [TaxId: 83333]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d6x1qd2:
![]() Domains from same chain: (mouse over for more information) d6x1qd1, d6x1qd3, d6x1qd4, d6x1qd5 |