![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (49 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [272122] (17 PDB entries) |
![]() | Domain d6x1qd1: 6x1q D:2-219 [388808] Other proteins in same PDB: d6x1qa2, d6x1qa3, d6x1qa4, d6x1qa5, d6x1qb2, d6x1qb3, d6x1qb4, d6x1qb5, d6x1qc2, d6x1qc3, d6x1qc4, d6x1qc5, d6x1qd2, d6x1qd3, d6x1qd4, d6x1qd5 automated match to d1f4ha3 complexed with mg, na |
PDB Entry: 6x1q (more details), 1.8 Å
SCOPe Domain Sequences for d6x1qd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6x1qd1 b.18.1.0 (D:2-219) automated matches {Escherichia coli [TaxId: 83333]} mitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfa wfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptg cysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrage nrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d6x1qd1:
![]() Domains from same chain: (mouse over for more information) d6x1qd2, d6x1qd3, d6x1qd4, d6x1qd5 |