Class b: All beta proteins [48724] (178 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
Protein automated matches [226849] (8 species) not a true protein |
Species Escherichia coli [TaxId:83333] [272144] (6 PDB entries) |
Domain d6x1qc5: 6x1q C:736-1022 [388805] Other proteins in same PDB: d6x1qa1, d6x1qa2, d6x1qa3, d6x1qa4, d6x1qb1, d6x1qb2, d6x1qb3, d6x1qb4, d6x1qc1, d6x1qc2, d6x1qc3, d6x1qc4, d6x1qd1, d6x1qd2, d6x1qd3, d6x1qd4 automated match to d1jz8a4 complexed with mg, na |
PDB Entry: 6x1q (more details), 1.8 Å
SCOPe Domain Sequences for d6x1qc5:
Sequence; same for both SEQRES and ATOM records: (download)
>d6x1qc5 b.30.5.0 (C:736-1022) automated matches {Escherichia coli [TaxId: 83333]} aiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldndigv seatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlfisrkt yridgsgqmaitvdvvvasdtphpariglncqlaqvaervnwlglgpqenypdrltaacf drwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmetshrhl lhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
Timeline for d6x1qc5:
View in 3D Domains from same chain: (mouse over for more information) d6x1qc1, d6x1qc2, d6x1qc3, d6x1qc4 |