Lineage for d6x1qa3 (6x1q A:334-625)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2441004Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2441005Protein automated matches [190075] (125 species)
    not a true protein
  7. 2441316Species Escherichia coli [TaxId:83333] [272137] (17 PDB entries)
  8. 2441317Domain d6x1qa3: 6x1q A:334-625 [388790]
    Other proteins in same PDB: d6x1qa1, d6x1qa2, d6x1qa4, d6x1qa5, d6x1qb1, d6x1qb2, d6x1qb4, d6x1qb5, d6x1qc1, d6x1qc2, d6x1qc4, d6x1qc5, d6x1qd1, d6x1qd2, d6x1qd4, d6x1qd5
    automated match to d1jz7a5
    complexed with mg, na

Details for d6x1qa3

PDB Entry: 6x1q (more details), 1.8 Å

PDB Description: 1.8 angstrom resolution structure of b-galactosidase with a 200 kv cryoarm electron microscope
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d6x1qa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6x1qa3 c.1.8.0 (A:334-625) automated matches {Escherichia coli [TaxId: 83333]}
vvriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d6x1qa3:

Click to download the PDB-style file with coordinates for d6x1qa3.
(The format of our PDB-style files is described here.)

Timeline for d6x1qa3: