Lineage for d1fhva2 (1fhv A:-3-99)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1904961Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 1905201Protein O-succinylbenzoate synthase [54834] (1 species)
  7. 1905202Species Escherichia coli [TaxId:562] [54835] (4 PDB entries)
  8. 1905205Domain d1fhva2: 1fhv A:-3-99 [38879]
    Other proteins in same PDB: d1fhva1
    complexed with mg, osb

Details for d1fhva2

PDB Entry: 1fhv (more details), 1.77 Å

PDB Description: crystal structure analysis of o-succinylbenzoate synthase from e. coli complexed with mg and osb
PDB Compounds: (A:) o-succinylbenzoate synthase

SCOPe Domain Sequences for d1fhva2:

Sequence, based on SEQRES records: (download)

>d1fhva2 d.54.1.1 (A:-3-99) O-succinylbenzoate synthase {Escherichia coli [TaxId: 562]}
gsamrsaqvyrwqipmdagvvlrdrrlktrdglyvclregeregwgeisplpgfsqetwe
eaqsvllawvnnwlagdcelpqmpsvafgvscalaeltdtlp

Sequence, based on observed residues (ATOM records): (download)

>d1fhva2 d.54.1.1 (A:-3-99) O-succinylbenzoate synthase {Escherichia coli [TaxId: 562]}
gsamrsaqvyrwqipmdagvvlrdrrlktrdglyvclregregwgeisplpgfsqetwee
aqsvllawvnnwlagdcelpqmpsvafgvscalaeltdtlp

SCOPe Domain Coordinates for d1fhva2:

Click to download the PDB-style file with coordinates for d1fhva2.
(The format of our PDB-style files is described here.)

Timeline for d1fhva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fhva1