SCOP 1.67: Domain d1fhva2: 1fhv A:-3-99

Lineage for d1fhva2 (1fhv A:-3-99)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (9 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein O-succinylbenzoate synthase [54834] (1 species)

7. Species Escherichia coli [TaxId:562] [54835] (3 PDB entries)

8. Domain d1fhva2: 1fhv A:-3-99 [38879]
   Other proteins in same PDB: d1fhva1
   complexed with mg, osb

Details for d1fhva2

PDB Entry: 1fhv, 1.77 Å

PDB Description: crystal structure analysis of o-succinylbenzoate synthase from e. coli complexed with mg and osb

SCOP Domain Sequences for d1fhva2:

Sequence, based on SEQRES records:

>d1fhva2 d.54.1.1 (A:-3-99) O-succinylbenzoate synthase {Escherichia coli}
gsamrsaqvyrwqipmdagvvlrdrrlktrdglyvclregeregwgeisplpgfsqetwe
eaqsvllawvnnwlagdcelpqmpsvafgvscalaeltdtlp

Sequence, based on observed residues (ATOM records):

>d1fhva2 d.54.1.1 (A:-3-99) O-succinylbenzoate synthase {Escherichia coli}
gsamrsaqvyrwqipmdagvvlrdrrlktrdglyvclregregwgeisplpgfsqetwee
aqsvllawvnnwlagdcelpqmpsvafgvscalaeltdtlp

Timeline for d1fhva2:

• d1fhva2 first appeared (with stable ids) in SCOP 1.55
  
• d1fhva2 appears in SCOP 1.65
  
• d1fhva2 appears in SCOP 1.69
  
• d1fhva2 appears in the current release, SCOPe 2.08