SCOP 1.67: Domain d1fhua2: 1fhu A:1-99

Lineage for d1fhua2 (1fhu A:1-99)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (9 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein O-succinylbenzoate synthase [54834] (1 species)

7. Species Escherichia coli [TaxId:562] [54835] (3 PDB entries)

8. Domain d1fhua2: 1fhu A:1-99 [38878]
   Other proteins in same PDB: d1fhua1

Details for d1fhua2

PDB Entry: 1fhu, 1.65 Å

PDB Description: crystal structure analysis of o-succinylbenzoate synthase from e. coli

SCOP Domain Sequences for d1fhua2:

Sequence, based on SEQRES records:

>d1fhua2 d.54.1.1 (A:1-99) O-succinylbenzoate synthase {Escherichia coli}
mrsaqvyrwqipmdagvvlrdrrlktrdglyvclregeregwgeisplpgfsqetweeaq
svllawvnnwlagdcelpqmpsvafgvscalaeltdtlp

Sequence, based on observed residues (ATOM records):

>d1fhua2 d.54.1.1 (A:1-99) O-succinylbenzoate synthase {Escherichia coli}
mrsaqvyrwqipmdlktrdglyvclregeregwgeisplpgfsqetweeaqsvllawvnn
wlagdcelpqmpsvafgvscalaeltdtlp

Timeline for d1fhua2:

• d1fhua2 first appeared (with stable ids) in SCOP 1.55
  
• d1fhua2 appears in SCOP 1.65
  
• d1fhua2 appears in SCOP 1.69
  
• d1fhua2 appears in the current release, SCOPe 2.08