Lineage for d1fhua2 (1fhu A:1-99)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) 
Family d.54.1.1: Enolase N-terminal domain-like [54827] (6 proteins) Protein O-succinylbenzoate synthase [54834] (1 species) Species Escherichia coli [TaxId:562] [54835] (2 PDB entries) 
Domain d1fhua2: 1fhu A:1-99 [38878]
Other proteins in same PDB: d1fhua1
Details for d1fhua2
PDB Entry: 1fhu (more details), 1.65 Å
PDB Description: crystal structure analysis of o-succinylbenzoate synthase from e. coli
SCOP Domain Sequences for d1fhua2:
Sequence, based on SEQRES records: (download)
>d1fhua2 d.54.1.1 (A:1-99) O-succinylbenzoate synthase {Escherichia coli}
mrsaqvyrwqipmdagvvlrdrrlktrdglyvclregeregwgeisplpgfsqetweeaq
svllawvnnwlagdcelpqmpsvafgvscalaeltdtlp
Sequence, based on observed residues (ATOM records): (download)
>d1fhua2 d.54.1.1 (A:1-99) O-succinylbenzoate synthase {Escherichia coli}
mrsaqvyrwqipmdlktrdglyvclregeregwgeisplpgfsqetweeaqsvllawvnn
wlagdcelpqmpsvafgvscalaeltdtlp
SCOP Domain Coordinates for d1fhua2:
Click to download the PDB-style file with coordinates for d1fhua2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fhua2:
- d1fhua2 appears in SCOP 1.57
- d1fhua2 appears in the current release, SCOPe 2.08
View in 3D
