Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Ubiquitin [54238] (9 species) |
Species Human (Homo sapiens) [TaxId:9606] [54239] (312 PDB entries) Uniprot P62988 identical sequence in many other species |
Domain d6w9rw1: 6w9r W:1-75 [388770] Other proteins in same PDB: d6w9rm2, d6w9rn2, d6w9ro2, d6w9rp2, d6w9rq2, d6w9rr2, d6w9rs2, d6w9rt2, d6w9ru2, d6w9rv2, d6w9rw2, d6w9rx2 automated match to d5ibkc_ complexed with flc |
PDB Entry: 6w9r (more details), 1.82 Å
SCOPe Domain Sequences for d6w9rw1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6w9rw1 d.15.1.1 (W:1-75) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrg
Timeline for d6w9rw1: