Class b: All beta proteins [48724] (180 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (8 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (63 PDB entries) |
Domain d6x2pb_: 6x2p B: [388757] Other proteins in same PDB: d6x2pa_ automated match to d5uwsb_ complexed with gnp, gol, mg |
PDB Entry: 6x2p (more details), 2.4 Å
SCOPe Domain Sequences for d6x2pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6x2pb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdktlkican hiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeefekaqei nkk
Timeline for d6x2pb_: