Lineage for d1ecqb2 (1ecq B:5-137)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170927Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2170928Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2170929Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 protein domains)
    C-terminal domain is beta/alpha-barrel
  6. 2170946Protein D-glucarate dehydratase [54831] (2 species)
  7. 2170947Species Escherichia coli [TaxId:562] [54833] (7 PDB entries)
  8. 2170967Domain d1ecqb2: 1ecq B:5-137 [38875]
    Other proteins in same PDB: d1ecqa1, d1ecqb1, d1ecqc1, d1ecqd1
    complexed with dxg, ipa, mg

Details for d1ecqb2

PDB Entry: 1ecq (more details), 2 Å

PDB Description: e. coli glucarate dehydratase bound to 4-deoxyglucarate
PDB Compounds: (B:) glucarate dehydratase

SCOPe Domain Sequences for d1ecqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecqb2 d.54.1.1 (B:5-137) D-glucarate dehydratase {Escherichia coli [TaxId: 562]}
fttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirkt
ledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldll
gqhlgvnvasllg

SCOPe Domain Coordinates for d1ecqb2:

Click to download the PDB-style file with coordinates for d1ecqb2.
(The format of our PDB-style files is described here.)

Timeline for d1ecqb2: