SCOPe 2.08: Domain d6x2vb_: 6x2v B:

Lineage for d6x2vb_ (6x2v B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (63 PDB entries)

8. Domain d6x2vb_: 6x2v B: [388744]
   Other proteins in same PDB: d6x2va_
   automated match to d5uwsb_
   complexed with gnp, gol, mg

Details for d6x2vb_

PDB Entry: 6x2v, 2.82 Å

PDB Description: crystal structure of pki(de)nes peptide bound to crm1

PDB Compounds: (B:) Ran-specific GTPase-activating protein 1

SCOPe Domain Sequences for d6x2vb_:

Sequence; same for both SEQRES and ATOM records:

>d6x2vb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
edeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdktlkicanhii
apeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeefekaqeinkk

Timeline for d6x2vb_:

• d6x2vb_ first appeared in SCOPe 2.07