Lineage for d6x1qb5 (6x1q B:736-1022)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391115Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2391261Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2391750Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 2391751Protein automated matches [226849] (8 species)
    not a true protein
  7. 2391834Species Escherichia coli [TaxId:83333] [272144] (6 PDB entries)
  8. 2391836Domain d6x1qb5: 6x1q B:736-1022 [388721]
    Other proteins in same PDB: d6x1qa1, d6x1qa2, d6x1qa3, d6x1qa4, d6x1qb1, d6x1qb2, d6x1qb3, d6x1qb4, d6x1qc1, d6x1qc2, d6x1qc3, d6x1qc4, d6x1qd1, d6x1qd2, d6x1qd3, d6x1qd4
    automated match to d1jz8a4
    complexed with mg, na

Details for d6x1qb5

PDB Entry: 6x1q (more details), 1.8 Å

PDB Description: 1.8 angstrom resolution structure of b-galactosidase with a 200 kv cryoarm electron microscope
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d6x1qb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d6x1qb5 b.30.5.0 (B:736-1022) automated matches {Escherichia coli [TaxId: 83333]}
aiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldndigv
seatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlfisrkt
yridgsgqmaitvdvvvasdtphpariglncqlaqvaervnwlglgpqenypdrltaacf
drwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmetshrhl
lhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq

SCOPe Domain Coordinates for d6x1qb5:

Click to download the PDB-style file with coordinates for d6x1qb5.
(The format of our PDB-style files is described here.)

Timeline for d6x1qb5: