SCOPe 2.07: Domain d6pspc_: 6psp C:

Lineage for d6pspc_ (6psp C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein automated matches [190087] (15 species)
   not a true protein

7. Species Methanotorris igneus [TaxId:2189] [379246] (3 PDB entries)

8. Domain d6pspc_: 6psp C: [388700]
   automated match to d1ki9b_
   complexed with ap5

Details for d6pspc_

PDB Entry: 6psp, 2.25 Å

PDB Description: adenylate kinase from methanococcus igneus - ap5a bound form

PDB Compounds: (C:) adenylate kinase

SCOPe Domain Sequences for d6pspc_:

Sequence; same for both SEQRES and ATOM records:

>d6pspc_ c.37.1.1 (C:) automated matches {Methanotorris igneus [TaxId: 2189]}
knkvvvvtgvpgvggttltqktieklkeegieykmvnfgtvmfevakeeglvedrdqmrk
ldpdtqkriqklagrkiaemakesnvivdthstvktpkgylaglpiwvleelnpdiiviv
etssdeilmrrlgdatrnrdieltsdidehqfmnrcaamaygvltgatvkiiknrdglld
kaveelisvlk

Timeline for d6pspc_:

• d6pspc_ is new in SCOPe 2.07-stable
  
• d6pspc_ appears in the current release, SCOPe 2.08