SCOPe 2.08: Domain d6up1b_: 6up1 B:

Lineage for d6up1b_ (6up1 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
   automatically mapped to Pfam PF00121

6. Protein Triosephosphate isomerase [51353] (21 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51355] (15 PDB entries)

8. Domain d6up1b_: 6up1 B: [388696]
   automated match to d1wyia_
   complexed with ipa; mutant

Details for d6up1b_

PDB Entry: 6up1, 1.83 Å

PDB Description: triosephosphate isomerase deficiency: effect of f240l mutation on enzyme structure

PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d6up1b_:

Sequence; same for both SEQRES and ATOM records:

>d6up1b_ c.1.1.1 (B:) Triosephosphate isomerase {Human (Homo sapiens) [TaxId: 9606]}
srkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkiava
aqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalaeglg
viacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqaq
evheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefvd
iinakq

Timeline for d6up1b_:

• d6up1b_ first appeared in SCOPe 2.07