Lineage for d1ec8d2 (1ec8 D:5-137)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. Protein D-glucarate dehydratase [54831] (2 species)
  7. Species Escherichia coli [TaxId:562] [54833] (7 PDB entries)
  8. Domain d1ec8d2: 1ec8 D:5-137 [38869]
    Other proteins in same PDB: d1ec8a1, d1ec8b1, d1ec8c1, d1ec8d1
    complexed with glr, ipa, mg

Details for d1ec8d2

PDB Entry: 1ec8 (more details), 1.9 Å

PDB Description: e. coli glucarate dehydratase bound to product 2,3-dihydroxy-5-oxo- hexanedioate
PDB Compounds: (D:) glucarate dehydratase

SCOPe Domain Sequences for d1ec8d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ec8d2 d.54.1.1 (D:5-137) D-glucarate dehydratase {Escherichia coli [TaxId: 562]}
fttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirkt
ledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldll
gqhlgvnvasllg

SCOPe Domain Coordinates for d1ec8d2 are not available.

Timeline for d1ec8d2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ec8d1
View in 3D
Domains from other chains:
(mouse over for more information)
d1ec8a1, d1ec8a2, d1ec8b1, d1ec8b2, d1ec8c1, d1ec8c2