Lineage for d6up5a_ (6up5 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826026Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2826027Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 2826028Protein Triosephosphate isomerase [51353] (21 species)
  7. 2826101Species Human (Homo sapiens) [TaxId:9606] [51355] (15 PDB entries)
  8. 2826120Domain d6up5a_: 6up5 A: [388681]
    automated match to d1wyia_
    complexed with gol, ipa, pga; mutant

Details for d6up5a_

PDB Entry: 6up5 (more details), 1.92 Å

PDB Description: triosephosphate isomerase deficiency: effect of f240l mutation on enzyme structure
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d6up5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6up5a_ c.1.1.1 (A:) Triosephosphate isomerase {Human (Homo sapiens) [TaxId: 9606]}
srkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkiava
aqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalaeglg
viacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqaq
evheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefvd
iinakq

SCOPe Domain Coordinates for d6up5a_:

Click to download the PDB-style file with coordinates for d6up5a_.
(The format of our PDB-style files is described here.)

Timeline for d6up5a_: