SCOPe 2.07: Domain d6ookb_: 6ook B:

Lineage for d6ookb_ (6ook B:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (30 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (106 PDB entries)

8. Domain d6ookb_: 6ook B: [388675]
   automated match to d4ua6a_
   complexed with mzv, po4

Details for d6ookb_

PDB Entry: 6ook, 1.4 Å

PDB Description: ctx-m-14 beta lactamase with compound 3

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d6ookb_:

Sequence; same for both SEQRES and ATOM records:

>d6ookb_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
avqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqsetqk
qllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpggv
tafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraqlv
twlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftqpqq
naesrrdvlasaariiaegl

Timeline for d6ookb_:

• d6ookb_ is new in SCOPe 2.07-stable
  
• d6ookb_ appears in the current release, SCOPe 2.08