Lineage for d1ec8b2 (1ec8 B:5-137)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
beta(3)-alpha(3); meander and up-and-down bundleSuperfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) 
Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
C-terminal domain is beta/alpha-barrel
Protein D-glucarate dehydratase [54831] (2 species) Species Escherichia coli [TaxId:562] [54833] (7 PDB entries) 
Domain d1ec8b2: 1ec8 B:5-137 [38867]
Other proteins in same PDB: d1ec8a1, d1ec8b1, d1ec8c1, d1ec8d1
complexed with glr, ipa, mg
Details for d1ec8b2
PDB Entry: 1ec8 (more details), 1.9 Å
PDB Description: e. coli glucarate dehydratase bound to product 2,3-dihydroxy-5-oxo- hexanedioate
PDB Compounds: (B:) glucarate dehydrataseSCOPe Domain Sequences for d1ec8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ec8b2 d.54.1.1 (B:5-137) D-glucarate dehydratase {Escherichia coli [TaxId: 562]}
fttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirkt
ledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldll
gqhlgvnvasllg
SCOPe Domain Coordinates for d1ec8b2:
Click to download the PDB-style file with coordinates for d1ec8b2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ec8b2:
View in 3D
