Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
Protein automated matches [190381] (11 species) not a true protein |
Species Escherichia coli [TaxId:562] [187229] (8 PDB entries) |
Domain d6u3ul_: 6u3u L: [388633] Other proteins in same PDB: d6u3ua_, d6u3ub_ automated match to d2ga4b_ complexed with edo, epe, zn |
PDB Entry: 6u3u (more details), 2.29 Å
SCOPe Domain Sequences for d6u3ul_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6u3ul_ b.40.2.1 (L:) automated matches {Escherichia coli [TaxId: 562]} adcakgkiefskynendtftvkvagkeywtnrwnlqpllqsaqltgmtvtiksstcasgs gfaevqfnnd
Timeline for d6u3ul_: