Lineage for d1ec7b2 (1ec7 B:5-137)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947583Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2947600Protein D-glucarate dehydratase [54831] (2 species)
  7. 2947601Species Escherichia coli [TaxId:562] [54833] (7 PDB entries)
  8. 2947609Domain d1ec7b2: 1ec7 B:5-137 [38863]
    Other proteins in same PDB: d1ec7a1, d1ec7b1, d1ec7c1, d1ec7d1
    complexed with ipa, mg

Details for d1ec7b2

PDB Entry: 1ec7 (more details), 1.9 Å

PDB Description: e. coli glucarate dehydratase native enzyme
PDB Compounds: (B:) glucarate dehydratase

SCOPe Domain Sequences for d1ec7b2:

Sequence, based on SEQRES records: (download)

>d1ec7b2 d.54.1.1 (B:5-137) D-glucarate dehydratase {Escherichia coli [TaxId: 562]}
fttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirkt
ledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldll
gqhlgvnvasllg

Sequence, based on observed residues (ATOM records): (download)

>d1ec7b2 d.54.1.1 (B:5-137) D-glucarate dehydratase {Escherichia coli [TaxId: 562]}
fttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirkt
ledaiplvvgktlgeyknvltlvrntfadrdgrglqtfdlrttihvvtgieaamldllgq
hlgvnvasllg

SCOPe Domain Coordinates for d1ec7b2:

Click to download the PDB-style file with coordinates for d1ec7b2.
(The format of our PDB-style files is described here.)

Timeline for d1ec7b2: