Lineage for d6ooea_ (6ooe A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2618351Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2619196Protein automated matches [190161] (30 species)
    not a true protein
  7. 2619286Species Escherichia coli [TaxId:562] [187306] (106 PDB entries)
  8. 2619349Domain d6ooea_: 6ooe A: [388624]
    automated match to d1ylpa_
    complexed with r6z

Details for d6ooea_

PDB Entry: 6ooe (more details), 1.26 Å

PDB Description: ctx-m-27 beta lactamase with compound 20
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6ooea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ooea_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
etsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
tqkqllnqpveikhadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
qlvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftq
pqqnaesrrdvlasaariiaegl

SCOPe Domain Coordinates for d6ooea_:

Click to download the PDB-style file with coordinates for d6ooea_.
(The format of our PDB-style files is described here.)

Timeline for d6ooea_: