Lineage for d1bqg_2 (1bqg 12-143)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602849Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 602850Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 602851Family d.54.1.1: Enolase N-terminal domain-like [54827] (12 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 602870Protein D-glucarate dehydratase [54831] (2 species)
  7. 602894Species Pseudomonas putida [TaxId:303] [54832] (1 PDB entry)
  8. 602895Domain d1bqg_2: 1bqg 12-143 [38861]
    Other proteins in same PDB: d1bqg_1

Details for d1bqg_2

PDB Entry: 1bqg (more details), 2.3 Å

PDB Description: the structure of the d-glucarate dehydratase protein from pseudomonas putida

SCOP Domain Sequences for d1bqg_2:

Sequence, based on SEQRES records: (download)

>d1bqg_2 d.54.1.1 (12-143) D-glucarate dehydratase {Pseudomonas putida}
gapvitdlkvvpvaghdsmllnlsgahgplftrnililtdssghvgvgevpggegirktl
edarhllinqsignyqsllnkvrnafadrdvggrglqtfdlriavhavtavesalldllg
qhlqvpvaallg

Sequence, based on observed residues (ATOM records): (download)

>d1bqg_2 d.54.1.1 (12-143) D-glucarate dehydratase {Pseudomonas putida}
gapvitdlkvvpvaghdsmllnlsgahgplftrnililtdssghvgvgevpggegirktl
edarhllinqsignyqsllnkvrnafadlriavhavtavesalldllgqhlqvpvaallg

SCOP Domain Coordinates for d1bqg_2:

Click to download the PDB-style file with coordinates for d1bqg_2.
(The format of our PDB-style files is described here.)

Timeline for d1bqg_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bqg_1