Lineage for d1bqga2 (1bqg A:12-143)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170927Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2170928Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2170929Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 protein domains)
    C-terminal domain is beta/alpha-barrel
  6. 2170946Protein D-glucarate dehydratase [54831] (2 species)
  7. 2170972Species Pseudomonas putida [TaxId:303] [54832] (1 PDB entry)
  8. 2170973Domain d1bqga2: 1bqg A:12-143 [38861]
    Other proteins in same PDB: d1bqga1

Details for d1bqga2

PDB Entry: 1bqg (more details), 2.3 Å

PDB Description: the structure of the d-glucarate dehydratase protein from pseudomonas putida
PDB Compounds: (A:) d-glucarate dehydratase

SCOPe Domain Sequences for d1bqga2:

Sequence, based on SEQRES records: (download)

>d1bqga2 d.54.1.1 (A:12-143) D-glucarate dehydratase {Pseudomonas putida [TaxId: 303]}
gapvitdlkvvpvaghdsmllnlsgahgplftrnililtdssghvgvgevpggegirktl
edarhllinqsignyqsllnkvrnafadrdvggrglqtfdlriavhavtavesalldllg
qhlqvpvaallg

Sequence, based on observed residues (ATOM records): (download)

>d1bqga2 d.54.1.1 (A:12-143) D-glucarate dehydratase {Pseudomonas putida [TaxId: 303]}
gapvitdlkvvpvaghdsmllnlsgahgplftrnililtdssghvgvgevpggegirktl
edarhllinqsignyqsllnkvrnafadlriavhavtavesalldllgqhlqvpvaallg

SCOPe Domain Coordinates for d1bqga2:

Click to download the PDB-style file with coordinates for d1bqga2.
(The format of our PDB-style files is described here.)

Timeline for d1bqga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bqga1