Lineage for d1pdy_2 (1pdy 1-139)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32233Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
  4. 32234Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 32235Family d.54.1.1: Enolase N-terminal domain-like [54827] (6 proteins)
  6. 32261Protein Enolase [54828] (2 species)
  7. 32278Species Lobster (Homarus vulgaris) [54830] (2 PDB entries)
  8. 32280Domain d1pdy_2: 1pdy 1-139 [38860]
    Other proteins in same PDB: d1pdy_1

Details for d1pdy_2

PDB Entry: 1pdy (more details), 2.4 Å

PDB Description: x-ray structure and catalytic mechanism of lobster enolase

SCOP Domain Sequences for d1pdy_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdy_2 d.54.1.1 (1-139) Enolase {Lobster (Homarus vulgaris)}
sitkvfartifdsrgnptvevdlytskglfraavpsgastgvhealemrdgdkskyhgks
vfnavknvndvivpeiiksglkvtqqkecdefmckldgtenksslganailgvslaicka
gaaelgiplyrhianlany

SCOP Domain Coordinates for d1pdy_2:

Click to download the PDB-style file with coordinates for d1pdy_2.
(The format of our PDB-style files is described here.)

Timeline for d1pdy_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pdy_1