SCOP 1.67: Domain d1pdz_2: 1pdz 1-139

Lineage for d1pdz_2 (1pdz 1-139)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (9 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Enolase [54828] (5 species)

7. Species Lobster (Homarus vulgaris) [54830] (2 PDB entries)

8. Domain d1pdz_2: 1pdz 1-139 [38859]
   Other proteins in same PDB: d1pdz_1
   complexed with mn, pga

Details for d1pdz_2

PDB Entry: 1pdz, 2.2 Å

PDB Description: x-ray structure and catalytic mechanism of lobster enolase

SCOP Domain Sequences for d1pdz_2:

Sequence; same for both SEQRES and ATOM records:

>d1pdz_2 d.54.1.1 (1-139) Enolase {Lobster (Homarus vulgaris)}
sitkvfartifdsrgnptvevdlytskglfraavpsgastgvhealemrdgdkskyhgks
vfnavknvndvivpeiiksglkvtqqkecdefmckldgtenksslganailgvslaicka
gaaelgiplyrhianlany

Timeline for d1pdz_2:

• d1pdz_2 first appeared (with stable ids) in SCOP 1.55
  
• d1pdz_2 appears in SCOP 1.65
  
• d1pdz_2 appears in SCOP 1.69
  
• d1pdz_2 appears in the current release, SCOPe 2.08, called d1pdza2