Lineage for d1pdz_2 (1pdz 1-139)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79862Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
  4. 79863Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 79864Family d.54.1.1: Enolase N-terminal domain-like [54827] (6 proteins)
  6. 79896Protein Enolase [54828] (2 species)
  7. 79913Species Lobster (Homarus vulgaris) [54830] (2 PDB entries)
  8. 79914Domain d1pdz_2: 1pdz 1-139 [38859]
    Other proteins in same PDB: d1pdz_1

Details for d1pdz_2

PDB Entry: 1pdz (more details), 2.2 Å

PDB Description: x-ray structure and catalytic mechanism of lobster enolase
PDB Compounds: ( :)

SCOP Domain Sequences for d1pdz_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdz_2 d.54.1.1 (1-139) Enolase {Lobster (Homarus vulgaris)}
sitkvfartifdsrgnptvevdlytskglfraavpsgastgvhealemrdgdkskyhgks
vfnavknvndvivpeiiksglkvtqqkecdefmckldgtenksslganailgvslaicka
gaaelgiplyrhianlany

SCOP Domain Coordinates for d1pdz_2:

Click to download the PDB-style file with coordinates for d1pdz_2.
(The format of our PDB-style files is described here.)

Timeline for d1pdz_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pdz_1