Lineage for d1nela2 (1nel A:1-141)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554473Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2554524Protein Enolase [54828] (10 species)
  7. 2554525Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (16 PDB entries)
  8. 2554552Domain d1nela2: 1nel A:1-141 [38858]
    Other proteins in same PDB: d1nela1
    complexed with f, mg, po4

Details for d1nela2

PDB Entry: 1nel (more details), 2.6 Å

PDB Description: fluoride inhibition of yeast enolase: crystal structure of the enolase-mg2+-f--pi complex at 2.6-angstroms resolution
PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d1nela2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nela2 d.54.1.1 (A:1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvsdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

SCOPe Domain Coordinates for d1nela2:

Click to download the PDB-style file with coordinates for d1nela2.
(The format of our PDB-style files is described here.)

Timeline for d1nela2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nela1