Lineage for d7enl_2 (7enl 1-141)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602849Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 602850Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 602851Family d.54.1.1: Enolase N-terminal domain-like [54827] (12 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 602896Protein Enolase [54828] (6 species)
  7. 602897Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (14 PDB entries)
  8. 602918Domain d7enl_2: 7enl 1-141 [38856]
    Other proteins in same PDB: d7enl_1
    complexed with 2pg, mg

Details for d7enl_2

PDB Entry: 7enl (more details), 2.2 Å

PDB Description: mechanism of enolase: the crystal structure of enolase-mg2+- phosphoglycerate(slash) phosphoenolpyruvate complex at 2.2-angstroms resolution

SCOP Domain Sequences for d7enl_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7enl_2 d.54.1.1 (1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvsdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

SCOP Domain Coordinates for d7enl_2:

Click to download the PDB-style file with coordinates for d7enl_2.
(The format of our PDB-style files is described here.)

Timeline for d7enl_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7enl_1