Lineage for d7enla2 (7enl A:1-141)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170927Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2170928Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2170929Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 protein domains)
    C-terminal domain is beta/alpha-barrel
  6. 2170980Protein Enolase [54828] (10 species)
  7. 2170981Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (16 PDB entries)
  8. 2171006Domain d7enla2: 7enl A:1-141 [38856]
    Other proteins in same PDB: d7enla1
    complexed with 2pg, mg

Details for d7enla2

PDB Entry: 7enl (more details), 2.2 Å

PDB Description: mechanism of enolase: the crystal structure of enolase-mg2+- phosphoglycerate(slash) phosphoenolpyruvate complex at 2.2-angstroms resolution
PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d7enla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7enla2 d.54.1.1 (A:1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvsdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

SCOPe Domain Coordinates for d7enla2:

Click to download the PDB-style file with coordinates for d7enla2.
(The format of our PDB-style files is described here.)

Timeline for d7enla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7enla1