SCOPe 2.07: Domain d6p6pa2: 6p6p A:334-502

Lineage for d6p6pa2 (6p6p A:334-502)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza a virus (a/sichuan/2/1987(h3n2)) [TaxId:62575] [388522] (1 PDB entry)

8. Domain d6p6pa2: 6p6p A:334-502 [388539]
   Other proteins in same PDB: d6p6pa1, d6p6pb1, d6p6pc1, d6p6pd1, d6p6pe1, d6p6pf1
   automated match to d5k9kf2
   complexed with bma, nag

Details for d6p6pa2

PDB Entry: 6p6p, 2.31 Å

PDB Description: crystal structure of hemagglutinin from influenza virus a/sichuan/2/1987 (h3n2)

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6p6pa2:

Sequence; same for both SEQRES and ATOM records:

>d6p6pa2 h.3.1.0 (A:334-502) automated matches {Influenza a virus (a/sichuan/2/1987(h3n2)) [TaxId: 62575]}
aiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaaidqingklnrliektnekfh
qiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfektrk
qlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfqi

Timeline for d6p6pa2:

• d6p6pa2 is new in SCOPe 2.07-stable
  
• d6p6pa2 appears in the current release, SCOPe 2.08