Lineage for d1ebga2 (1ebg A:1-141)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79862Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
  4. 79863Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 79864Family d.54.1.1: Enolase N-terminal domain-like [54827] (6 proteins)
  6. 79896Protein Enolase [54828] (2 species)
  7. 79897Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (11 PDB entries)
  8. 79907Domain d1ebga2: 1ebg A:1-141 [38853]
    Other proteins in same PDB: d1ebga1, d1ebgb1

Details for d1ebga2

PDB Entry: 1ebg (more details), 2.1 Å

PDB Description: chelation of ser 39 to mg2+ latches a gate at the active site of enolase: structure of the bis(mg2+) complex of yeast enolase and the intermediate analog phosphonoacetohydroxamate at 2.1 angstroms resolution
PDB Compounds: (A:)

SCOP Domain Sequences for d1ebga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebga2 d.54.1.1 (A:1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

SCOP Domain Coordinates for d1ebga2:

Click to download the PDB-style file with coordinates for d1ebga2.
(The format of our PDB-style files is described here.)

Timeline for d1ebga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ebga1