Lineage for d6p6pc1 (6p6p C:8-326)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385196Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2385197Protein Hemagglutinin [49824] (19 species)
    includes rudiment esterase domain
  7. 2385257Species Influenza a virus (a/sichuan/2/1987(h3n2)) [TaxId:62575] [388520] (1 PDB entry)
  8. 2385260Domain d6p6pc1: 6p6p C:8-326 [388521]
    Other proteins in same PDB: d6p6pa2, d6p6pb2, d6p6pc2, d6p6pd2, d6p6pe2, d6p6pf2
    automated match to d5k9kf1
    complexed with bma, nag

Details for d6p6pc1

PDB Entry: 6p6p (more details), 2.31 Å

PDB Description: crystal structure of hemagglutinin from influenza virus a/sichuan/2/1987 (h3n2)
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d6p6pc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6p6pc1 b.19.1.2 (C:8-326) Hemagglutinin {Influenza a virus (a/sichuan/2/1987(h3n2)) [TaxId: 62575]}
nstatlclghhavpngtlvktitndqievtnatelvqssstgricdsphrildgknctli
dallgdphcdgfqnekwdlfverskaysncypydvpdyaslrslvassgtlefinedfnw
igvtqsggscackrgsvnsffsrlnwlheseqkypalnvtmpnngkfdklyiwgvhhpst
dreqtnlyvrasgrvtvstkrsqqtvipnigsrpwvrglssrisiywtivkpgdillins
ignliaprgyfkirtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpr
yvkqntlklatgmrnvpek

SCOPe Domain Coordinates for d6p6pc1:

Click to download the PDB-style file with coordinates for d6p6pc1.
(The format of our PDB-style files is described here.)

Timeline for d6p6pc1: