SCOP 1.57: Domain d6enl_2: 6enl 1-141

Lineage for d6enl_2 (6enl 1-141)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (6 proteins)

6. Protein Enolase [54828] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (11 PDB entries)

8. Domain d6enl_2: 6enl 1-141 [38852]
   Other proteins in same PDB: d6enl_1

Details for d6enl_2

PDB Entry: 6enl, 2.2 Å

PDB Description: inhibition of enolase: the crystal structures of enolase-ca2+- phosphoglycerate and enolase-zn2+-phosphoglycolate complexes at 2.2- angstroms resolution

SCOP Domain Sequences for d6enl_2:

Sequence; same for both SEQRES and ATOM records:

>d6enl_2 d.54.1.1 (1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvsdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

Timeline for d6enl_2:

• d6enl_2 first appeared (with stable ids) in SCOP 1.55
  
• d6enl_2 appears in SCOP 1.59
  
• d6enl_2 appears in the current release, SCOPe 2.08, called d6enla2