SCOPe 2.08: Domain d6kd6d_: 6kd6 D:

Lineage for d6kd6d_ (6kd6 D:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.0: automated matches [191625] (1 protein)
   not a true family

6. Protein automated matches [191144] (3 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [231239] (5 PDB entries)

8. Domain d6kd6d_: 6kd6 D: [388516]
   Other proteins in same PDB: d6kd6b2
   automated match to d2m16a_

Details for d6kd6d_

PDB Entry: 6kd6, 1.58 Å

PDB Description: shuguo pwwp domain

PDB Compounds: (D:) LD23804p

SCOPe Domain Sequences for d6kd6d_:

Sequence, based on SEQRES records:

>d6kd6d_ b.34.9.0 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sysigdlvfakvkgyppwpakitksnnnkkynvyfygtgetanikledlfpyasnkerfa
tekimkrakfieaidqiesalrg

Sequence, based on observed residues (ATOM records):

>d6kd6d_ b.34.9.0 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sysigdlvfakvkgyppwpakitkskkynvyfygtgetanikledlfpyasnkerfatek
imkrakfieaidqiesalrg

Timeline for d6kd6d_:

• d6kd6d_ first appeared in SCOPe 2.07