Lineage for d5enla2 (5enl A:1-141)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947583Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2947634Protein Enolase [54828] (10 species)
  7. 2947635Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (16 PDB entries)
  8. 2947657Domain d5enla2: 5enl A:1-141 [38851]
    Other proteins in same PDB: d5enla1
    complexed with 2pg, ca

Details for d5enla2

PDB Entry: 5enl (more details), 2.2 Å

PDB Description: inhibition of enolase: the crystal structures of enolase-ca2+- phosphoglycerate and enolase-zn2+-phosphoglycolate complexes at 2.2- angstroms resolution
PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d5enla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5enla2 d.54.1.1 (A:1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvsdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

SCOPe Domain Coordinates for d5enla2:

Click to download the PDB-style file with coordinates for d5enla2.
(The format of our PDB-style files is described here.)

Timeline for d5enla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5enla1