Lineage for d6l0ca_ (6l0c A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886113Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
    Pfam PF00665
  6. 2886283Protein automated matches [190209] (5 species)
    not a true protein
  7. 2886284Species Human immunodeficiency virus 1 [TaxId:11676] [186963] (69 PDB entries)
  8. 2886400Domain d6l0ca_: 6l0c A: [388504]
    automated match to d3vq9c_
    complexed with ars, so4

Details for d6l0ca_

PDB Entry: 6l0c (more details), 2.1 Å

PDB Description: crystal structure of hiv-1 integrase catalytic core domain (a128t/k173q/f185k)
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d6l0ca_:

Sequence, based on SEQRES records: (download)

>d6l0ca_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvktacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlqta
vqmavfihnkkrkggiggysagerivdiiatdi

Sequence, based on observed residues (ATOM records): (download)

>d6l0ca_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvktacwwagikqefgiesmnkelkkiigqvrdqaehlqtavqmavfihnk
krkggysagerivdiiatdi

SCOPe Domain Coordinates for d6l0ca_:

Click to download the PDB-style file with coordinates for d6l0ca_.
(The format of our PDB-style files is described here.)

Timeline for d6l0ca_: