Lineage for d1ebhb2 (1ebh B:1-141)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602849Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 602850Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 602851Family d.54.1.1: Enolase N-terminal domain-like [54827] (12 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 602896Protein Enolase [54828] (6 species)
  7. 602897Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (14 PDB entries)
  8. 602906Domain d1ebhb2: 1ebh B:1-141 [38850]
    Other proteins in same PDB: d1ebha1, d1ebhb1
    complexed with cl, mg

Details for d1ebhb2

PDB Entry: 1ebh (more details), 1.9 Å

PDB Description: octahedral coordination at the high affinity metal site in enolase; crystallographic analysis of the mg++-enzyme from yeast at 1.9 angstroms resolution

SCOP Domain Sequences for d1ebhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebhb2 d.54.1.1 (B:1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

SCOP Domain Coordinates for d1ebhb2:

Click to download the PDB-style file with coordinates for d1ebhb2.
(The format of our PDB-style files is described here.)

Timeline for d1ebhb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ebhb1