SCOPe 2.08: Domain d1ebhb2: 1ebh B:1-141

Lineage for d1ebhb2 (1ebh B:1-141)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Enolase [54828] (10 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (16 PDB entries)

8. Domain d1ebhb2: 1ebh B:1-141 [38850]
   Other proteins in same PDB: d1ebha1, d1ebhb1
   complexed with cl, mg

Details for d1ebhb2

PDB Entry: 1ebh, 1.9 Å

PDB Description: octahedral coordination at the high affinity metal site in enolase; crystallographic analysis of the mg++-enzyme from yeast at 1.9 angstroms resolution

PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d1ebhb2:

Sequence; same for both SEQRES and ATOM records:

>d1ebhb2 d.54.1.1 (B:1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

Timeline for d1ebhb2:

• d1ebhb2 first appeared (with stable ids) in SCOP 1.55
  
• d1ebhb2 appears in SCOPe 2.07