SCOPe 2.08: Domain d6x5la_: 6x5l A:

Lineage for d6x5la_ (6x5l A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Coagulation factor IXa, protease domain [50583] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50585] (21 PDB entries)

8. Domain d6x5la_: 6x5l A: [388473]
   Other proteins in same PDB: d6x5lb_
   automated match to d3lc3a_
   complexed with cit, gol, na, uqg

Details for d6x5la_

PDB Entry: 6x5l, 2.25 Å

PDB Description: discovery of hydroxy pyrimidine factor ixa inhibitors

PDB Compounds: (A:) coagulation factor ix

SCOPe Domain Sequences for d6x5la_:

Sequence, based on SEQRES records:

>d6x5la_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]}
vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnynaainkynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftiynnmfcagfheggrds
cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektkl

Sequence, based on observed residues (ATOM records):

>d6x5la_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]}
vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvegvkitvvagehnieet
ehteqkrnviriiphhnynaainkynhdialleldeplvlnsyvtpiciadkeytniflk
fgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftiynnmfcagfheggrdsc
qgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektkl

Timeline for d6x5la_:

• d6x5la_ first appeared in SCOPe 2.07